PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10020140m
Common NameCARUB_v10020140mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family TALE
Protein Properties Length: 525aa    MW: 59821.2 Da    PI: 6.8066
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10020140mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.81.1e-093684051954
                      HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
         Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      Fe   ++yp+++e+  L+k++gL+++qV +WF N R +
  Carubv10020140m 368 FEHflHPYPKESEKIMLSKQTGLSKNQVANWFINARVR 405
                      665559******************************88 PP

2BELL125.42.2e-40231302172
             BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                      erqelq+kk+kLl++++eVdkrY+qy++q+++++ssFe+v+glg+akpYts+Al++iSrhFrcL+dai+eqi
  Carubv10020140m 231 ERQELQNKKSKLLTMVDEVDKRYNQYHHQMEALASSFEMVTGLGAAKPYTSVALNRISRHFRCLRDAIKEQI 302
                      79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.4E-51164300IPR006563POX domain
PfamPF075266.2E-48170298IPR006563POX domain
PROSITE profilePS5007112.066346409IPR001356Homeobox domain
CDDcd000864.03E-11349410No hitNo description
SMARTSM003891.9E-9349413IPR001356Homeobox domain
SuperFamilySSF466893.17E-17350416IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.7E-28352415IPR009057Homeodomain-like
PfamPF059201.8E-17366405IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 525 aa     Download sequence    Send to blast
MAVYYPNSVG MQSLYQESIY LNEQQQQQQA SSSSAASFSE IVSGGVRNNN EMVFIPPTSD  60
VAVNGNVTVS SNDLSFHGGG LSLSLGNQIQ SAVSVSPFQY HYQNLSNQLN YSNPNASTMS  120
DENGKSLSGH HHHQQQHHSD QMIPSSGYNN NGVGFFNNYR YETSGFVSSV LRSRYLKPTQ  180
QLLDEVVSVR KELKLGNKKM KNDKGQDFQN GSSDNITEDE KSQSQELSPS ERQELQNKKS  240
KLLTMVDEVD KRYNQYHHQM EALASSFEMV TGLGAAKPYT SVALNRISRH FRCLRDAIKE  300
QIQVIRGKLG ERETSEEQGE RIPRLRYLDQ RLRQQRALHQ QLGMVRPAWR PQRGLPENSV  360
SILRAWLFEH FLHPYPKESE KIMLSKQTGL SKNQVANWFI NARVRLWKPM IEEMYKEEFG  420
DSELLSNSNQ DNNKMLETSQ LKHEESSLQQ QNQGNNNNNM AYRSDAEENL VFADPKPDRV  480
ATGEYDSLMN YHGFGIDDYN RYVGLGNQQD GRFSNPHQLH DFVV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_B8e-16355413563Homeobox protein Meis2
3k2a_A8e-16355413563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3530930.0AF353093.1 Arabidopsis thaliana BEL1-like homeodomain 3 (BLH3) mRNA, complete cds.
GenBankAY0852780.0AY085278.1 Arabidopsis thaliana clone 142443 mRNA, complete sequence.
GenBankAY5984520.0AY598452.1 Arabidopsis thaliana BEL1-like homeodomain 3 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006302135.10.0hypothetical protein CARUB_v10020140mg
SwissprotQ9FWS90.0BLH3_ARATH; BEL1-like homeodomain protein 3
TrEMBLR0IEB00.0R0IEB0_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.2__1821__AT1G75410.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38201959
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75410.20.0BEL1-like homeodomain 3